Skip to product information
1 of 1

Gene Bio Systems

Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1)

Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1)

SKU:CSB-CF314084EEZ

Regular price ¥274,600 JPY
Regular price Sale price ¥274,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Uniprot NO.:P0C6Z1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIER NSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQS TPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVI CSYLFISRGRH

Protein Names:Recommended name: Apoptosis regulator BHRF1 Alternative name(s): Early antigen protein R Short name= EA-R Nuclear antigen

Gene Names:ORF Names:BHRF1

Expression Region:1-191

Sequence Info:full length protein

View full details