Gene Bio Systems
Recombinant Enterobacteria phage PRD1 Protein P34(XXXIV)
Recombinant Enterobacteria phage PRD1 Protein P34(XXXIV)
SKU:CSB-CF338833EDO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterobacteria phage PRD1 (Bacteriophage PRD1)
Uniprot NO.:P27390
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNDFVGPIVTVLTAIIGVAILAVLVSRNSNTAGVIKAGSGGFSSMLGTALSPVTGGTGFA MTNNYSGF
Protein Names:Recommended name: Protein P34 Short name= Protein O Alternative name(s): GpO
Gene Names:Name:XXXIV Synonyms:O
Expression Region:1-68
Sequence Info:full length protein
