Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B(stxB)

SKU: CSB-YP300809EKZ

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P69179

Gene Names: stxB

Organism: Enterobacteria phage H19B (Bacteriophage H19B)

AA Sequence: TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Expression Region: 21-89aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 9.7 kDa

Alternative Name(s): Verocytotoxin 1 subunit B ;Verotoxin 1 subunit B

Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Reference: Nucleotide sequence of the Shiga-like toxin genes of Escherichia coli.Calderwood S.B., Auclair F., Donohue-Rolfe A., Keusch G.T., Mekalanos J.J.Proc. Natl. Acad. Sci. U.S.A. 84:4364-4368(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.