Recombinant Enterobacter sp.  Fumarate reductase subunit C(frdC)

Recombinant Enterobacter sp. Fumarate reductase subunit C(frdC)

CSB-CF394662EIZ
Regular price
¥174,100 JPY
Sale price
¥174,100 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Enterobacter sp. (strain 638)

Uniprot NO.:A4W5P9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTKRKAYVRPMPSTWWKKLPFYRFYMLREGTAVPAVWFSLELMYGVFALKHGPETWADF VGFLQNPVVLILNLIVLAAALLHTKTWFELAPKAANIIVKGEKMGPEPVIKGLWAVTAVV TAVVLFVALFW

Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein

Gene Names:Name:frdC Ordered Locus Names:Ent638_0341

Expression Region:1-131

Sequence Info:full length protein

Your list is ready to share