Skip to product information
1 of 1

Gene Bio Systems

Recombinant Entamoeba histolytica Multidrug resistance protein 1(MDR1)

Recombinant Entamoeba histolytica Multidrug resistance protein 1(MDR1)

SKU:CSB-YP001046EKM

Regular price ¥181,400 JPY
Regular price Sale price ¥181,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P16875

Gene Names: MDR1

Organism: Entamoeba histolytica

AA Sequence: SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI

Expression Region: 1-114aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 14.5 kDa

Alternative Name(s): P-glycoprotein

Relevance: Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Reference: Emetine-resistant mutants of Entamoeba histolytica overexpress mRNAs for multidrug resistance.Samuelson J., Ayala P., Orozco E., Wirth D.Mol. Biochem. Parasitol. 38:281-290(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details