Gene Bio Systems
Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU02_1470(ECU02_1470)
Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU02_1470(ECU02_1470)
SKU:CSB-CF848363EKH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Uniprot NO.:Q8SW90
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQGGIQEEKTFQRNIKEALGDKDVTRDFFNIGRICVPQNLNDAKRRVFANLDRFKFHYLA MTAIFTLIYVLYRLELIILIGIVAAGVYAYRVRPTVCNIELEPRSVCIAGFVGILIFFIF FKEAIVGLLAISALCGIVTLTHAALLGEGLQKDDEV
Protein Names:Recommended name: Uncharacterized membrane protein ECU02_1470
Gene Names:Ordered Locus Names:ECU02_1470
Expression Region:1-156
Sequence Info:full length protein
