Gene Bio Systems
Recombinant Edwardsiella ictaluri UPF0266 membrane protein NT01EI_1718 (NT01EI_1718)
Recombinant Edwardsiella ictaluri UPF0266 membrane protein NT01EI_1718 (NT01EI_1718)
SKU:CSB-CF509346EJO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Edwardsiella ictaluri (strain 93-146)
Uniprot NO.:C5BDX6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLTDIALLVFIVLFLLYAIYDEAIMPRQRSATLLRVNLKRRNKADSLIFIGLLAILVYR NISDQGAPFTTWLLATLMVVAIYIFYLRWPKLLFKQQGFYYGNVFIDYARIRGMNLSEDG FLVIDLEKRRLLIQVANLDSLDEIFKFLLEHQQKPA
Protein Names:Recommended name: UPF0266 membrane protein NT01EI_1718
Gene Names:Ordered Locus Names:NT01EI_1718
Expression Region:1-156
Sequence Info:full length protein
