Skip to product information
1 of 1

Gene Bio Systems

Recombinant Edwardsiella ictaluri Probable intracellular septation protein A (NT01EI_1681)

Recombinant Edwardsiella ictaluri Probable intracellular septation protein A (NT01EI_1681)

SKU:CSB-CF509343EJO

Regular price ¥273,800 JPY
Regular price Sale price ¥273,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Edwardsiella ictaluri (strain 93-146)

Uniprot NO.:C5BDB0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQLLDFLPLVVFFVCYKLYDIYVASGALVAATAVALVLTWLKYRRVEKMTLITFIMVAI FGTLTLVFHNDLFIKWKVTVIYTLFALALLISQVVLKKPLIQRMLGKELQLPDSVWSRLN AAWALFFLGCGLANIYVAFWLPQSVWVDFKVFGLTALTLVFTLLSGIYIYRNMSEEQKHS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:NT01EI_1681

Expression Region:1-180

Sequence Info:full length protein

View full details