Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila simulans Cytochrome c oxidase subunit 3(mt:CoIII)

Recombinant Drosophila simulans Cytochrome c oxidase subunit 3(mt:CoIII)

SKU:CSB-CF015074DMJ

Regular price ¥218,900 JPY
Regular price Sale price ¥218,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila simulans (Fruit fly)

Uniprot NO.:P50271

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTHSNHPFHLVDYSPWPLTGAIGAMTTVSGMVKWFHQYDMSLFLLGNIITILTVYQWWR DVSREGTYQGLHTY

Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide III

Gene Names:Name:mt:CoIII Synonyms:CoIII

Expression Region:1-74

Sequence Info:full length protein

View full details