Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila pseudoobscura pseudoobscura Sugar transporter SWEET1(slv)

Recombinant Drosophila pseudoobscura pseudoobscura Sugar transporter SWEET1(slv)

SKU:CSB-CF642746DME

Regular price ¥282,700 JPY
Regular price Sale price ¥282,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Drosophila pseudoobscura pseudoobscura (Fruit fly)

Uniprot NO.:Q290X1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAVAYELLSTTAVISTVFQFLSGAMICRKYIQKKSTGDSSGVPFICGFLSCSFWLRYGV LTEEQSIVLVNIIGSTLFLIYTLIYYVFTVNKRAFVRQFAFVLAVLIAVVVVYTNRLADQ RDEMIRITGIFCCIVTVCFFAAPLATLLHVIRAKNSESLPLPLIATSFLVSLQWLIYGIL ISDSFIQIPNFLGCLLSMLQLSLFVVYPPRSYSGQGYKLVEQAVPF

Protein Names:Recommended name: Sugar transporter SWEET1 Alternative name(s): Protein saliva

Gene Names:Name:slv ORF Names:GA21278

Expression Region:1-226

Sequence Info:full length protein

View full details