Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster V-type proton ATPase 16 kDa proteolipid subunit(Vha16-1)

Recombinant Drosophila melanogaster V-type proton ATPase 16 kDa proteolipid subunit(Vha16-1)

SKU:CSB-CF002389DLU

Regular price ¥269,800 JPY
Regular price Sale price ¥269,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:P23380

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIP VVMAGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDA GVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK

Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Short name= VHA16K Alternative name(s): Ductin Vacuolar H+ ATPase subunit 16-1 Vacuolar proton pump 16 kDa prot

Gene Names:Name:Vha16-1 Synonyms:VHA, Vha16 ORF Names:CG3161

Expression Region:1-159

Sequence Info:full length protein

View full details