Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA(UbcD6)

Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA(UbcD6)

SKU:CSB-EP328517DLU

Regular price ¥165,300 JPY
Regular price Sale price ¥165,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P25153

Gene Names: UbcD6

Organism: Drosophila melanogaster (Fruit fly)

AA Sequence: MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID

Expression Region: 1-151aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.2 kDa

Alternative Name(s): Ubiquitin carrier proteinUbiquitin-protein ligase

Relevance: Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA.

Reference: Dhr6, a Drosophila homolog of the yeast DNA-repair gene RAD6.Koken M.H.M., Reynolds P., Bootsma D., Hoeijmakers J.H.J., Prakash S., Prakash L.Proc. Natl. Acad. Sci. U.S.A. 88:3832-3836(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details