Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Putative oligosaccharyltransferase complex subunit CG9662(CG9662)

Recombinant Drosophila melanogaster Putative oligosaccharyltransferase complex subunit CG9662(CG9662)

SKU:CSB-CF895646DLU

Regular price ¥266,600 JPY
Regular price Sale price ¥266,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q9VQP9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIETLYNLPFHILVPPNIKVRRFSIPMPSPMAVFSVILFSYFLVTGGIIYDVIVEPPSLG ATVDEHGHSRPVAFMPYRVNGQYIMEGLASSFLFTVGGLGFIIMDQTHTPGKTNLNRLLL TAMGFIFILVSFFTTWLFMRMKLPSYLQP

Protein Names:Recommended name: Putative oligosaccharyltransferase complex subunit CG9662

Gene Names:ORF Names:CG9662

Expression Region:1-149

Sequence Info:full length protein

View full details