Gene Bio Systems
Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 1(Tim17b1)
Recombinant Drosophila melanogaster Probable mitochondrial import inner membrane translocase subunit Tim17 1(Tim17b1)
SKU:CSB-CF896124DLU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila melanogaster (Fruit fly)
Uniprot NO.:Q9VNA0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSG LVGGNFAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGG ALLALIEGVGIVVSHYSADSYRQVSPVERQQRYKQELLRQQKGVSPLAATYGEIDSSAL
Protein Names:Recommended name: Probable mitochondrial import inner membrane translocase subunit Tim17 1
Gene Names:Name:Tim17b1 ORF Names:CG1158
Expression Region:1-179
Sequence Info:full length protein
