Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Mitochondrial import inner membrane translocase subunit Tim22(Tim22)

Recombinant Drosophila melanogaster Mitochondrial import inner membrane translocase subunit Tim22(Tim22)

SKU:CSB-CF812853DLU

Regular price ¥275,600 JPY
Regular price Sale price ¥275,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q8IN78

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVLPNAGNNESSVTAPKMFGDPDLDRMAMEYVGNMQRYRENIIIPKSNGPVKIKTNEEK FIETAVESCGFKCTMACVMGYGLGAALGLFSASVNPNMADPFANEKKQTAREVFREMRST THSYAKNFALIGCVFSAVECTIESHRGVTDWKNGTYAGGITGGLIGLRAGVKAGIIGGLG FAAFSTAIDYYMYSR

Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit Tim22

Gene Names:Name:Tim22 ORF Names:CG31229

Expression Region:1-195

Sequence Info:full length protein

View full details