Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster Calcium channel flower(fwe)

Recombinant Drosophila melanogaster Calcium channel flower(fwe)

SKU:CSB-CF836120DLU

Regular price ¥275,400 JPY
Regular price Sale price ¥275,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q95T12

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRLLGIVAAFFAILFGLWNVFSIITLSVS CLVAGILQMVAGFVVMLLEAPCCFVCFGQVNEIAEKVESKPLYFRAGLYIAMAIPPIILC FGLASLFGSGLIFGTGVVYGMMALGKKASAEDMRAAAQQTFGGNTPAQTNDRAGIVNNAQ PFSFTGAVGTDSNV

Protein Names:Recommended name: Calcium channel flower Short name= 3L5

Gene Names:Name:fwe Synonyms:flower ORF Names:CG6151

Expression Region:1-194

Sequence Info:full length protein

View full details