Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog Transmembrane protein 190(TMEM190)

Recombinant Dog Transmembrane protein 190(TMEM190)

SKU:CSB-CF023780DO

Regular price ¥268,700 JPY
Regular price Sale price ¥268,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Canis familiaris (Dog) (Canis lupus familiaris)

Uniprot NO.:E2R0A5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:NGIQGFFYPWSCEGDVWDRESCGGQAAIENPNLCLRLRCCYRDGVCYHQRPDETMRRKHMWALGWTCGGLLFLISSICLFWWAKRRDMLHLPGFLKGKCDLSRTVSLLSKDRGTLSDKKTSAGSVPTSLPTEGNADVSGATEGEGTTEGGEETEGGEDED

Protein Names:Recommended name: Transmembrane protein 190

Gene Names:Name:TMEM190

Expression Region:22-181

Sequence Info:full length protein

View full details