Gene Bio Systems
Recombinant Dog Signal peptidase complex catalytic subunit SEC11A(SEC11A)
Recombinant Dog Signal peptidase complex catalytic subunit SEC11A(SEC11A)
SKU:CSB-CF020931DO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Canis familiaris (Dog) (Canis lupus familiaris)
Uniprot NO.:P67811
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE
Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11A EC= 3.4.21.89 Alternative name(s): Endopeptidase SP18 Microsomal signal peptidase 18 kDa subunit Short name= SPase 18 kDa subunit SEC11 homolog A SEC11-like protein 1 SPC18
Gene Names:Name:SEC11A Synonyms:SEC11L1, SPC18
Expression Region:1-179
Sequence Info:full length protein
