Gene Bio Systems
Recombinant Dog Phospholemman(FXYD1)
Recombinant Dog Phospholemman(FXYD1)
SKU:CSB-CF009089DO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Canis familiaris (Dog) (Canis lupus familiaris)
Uniprot NO.:P56513
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EAPQEHDPFTYDYQSLRIGGLIIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Protein Names:Recommended name: Phospholemman Alternative name(s): FXYD domain-containing ion transport regulator 1
Gene Names:Name:FXYD1 Synonyms:PLM
Expression Region:21-92
Sequence Info:full length protein
