Recombinant Dog Minor allergen Can f 2

Recombinant Dog Minor allergen Can f 2

CSB-EP521201DO
Regular price
¥123,500 JPY
Sale price
¥123,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Canis lupus familiaris (Dog) (Canis familiaris)

Delivery time: 3-7 business days

Uniprot ID: O18874

AA Sequence: QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 19-180aa

Protein length: Full Length

MW: 34.4 kDa

Alternative Name(s): Allergen Dog 2 Allergen: Can f 2

Relevance:

Reference: "The major dog allergens, Can f 1 and Can f 2, are salivary lipocalin proteins: cloning and immunological characterization of the recombinant forms."Konieczny A., Morgenstern J.P., Bizinkauskas C.B., Lilley C.H., Brauer A.W., Bond J.F., Aalberse R.C., Wallner B.P., Kasaian M.T.Immunology 92:577-586(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share