Recombinant Dog Interleukin-2 receptor subunit beta isoform 1 precursor (IL2RB), partial

SKU: A0A8C0MT13

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: A0A8C0MT13

Gene Names: IL2RB

Alternative Name(s): High affinity IL-2 receptor subunit beta

Abbreviation: Recombinant Dog IL2RB protein, partial

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

Source: Mammalian cell

Expression Region: 30-246aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: NADTSKLTCFYNSKANISCIWSWDGDLQATSCKIHAQPDRRPWNKSCELLPMRPAFWACYLILGSPDAQSLTSADVVGMSVMCHEGERWRILMTQDFKPFENLRLMAPNGLQVADVGTHKCNITWKVPQSSHYIKRYLEFEARKRSPGHSWEEASLMALRQNQQWISLETLTPDTLYEFQVRVRAQRGSHKTWSPWSQPLAFRTRPAARGKQSLPFP

MW: 26.5 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference:

Function: