Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog Cytokine receptor common subunit gamma(IL2RG)

Recombinant Dog Cytokine receptor common subunit gamma(IL2RG)

SKU:CSB-CF011651DO

Regular price ¥299,700 JPY
Regular price Sale price ¥299,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Canis familiaris (Dog) (Canis lupus familiaris)

Uniprot NO.:P40321

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LNSTVPMPNGNEDITPDFFLTATPSETLSVSSLPLPEVQCFVFNVEYMNCTWNSSSEPRPTNLTLHYWYKNSNDDKVQECGHYLFSREVTAGCWLQKEEIHLYETFVVQLRDPREPRRQSTQKLKLQNLVIPWAPENLTLHNLSESQLELSWSNRHLDHCLEHVVQYRSDWDRSWTEQSVDHRNSFSLPSVDGQKFYTFRVRSRYNPLCGSAQRWSEWSHPIHWGSNTSKENPLFASEAVLIPLGSMGLIISLICVYYWLERSIPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEIPPKGGAPGEGPGGSPCSQHSPYWAPPCYTLKPETGALIP

Protein Names:Recommended name: Cytokine receptor common subunit gamma Alternative name(s): Interleukin-2 receptor subunit gamma Short name= IL-2 receptor subunit gamma Short name= IL-2R subunit gamma Short name= IL-2RG gammaC p64 CD_antigen= CD132

Gene Names:Name:IL2RG

Expression Region:23-373

Sequence Info:full length protein

View full details