Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dog B-cell antigen receptor complex-associated protein alpha chain(CD79A)

Recombinant Dog B-cell antigen receptor complex-associated protein alpha chain(CD79A)

SKU:CSB-CF004957DO

Regular price ¥272,200 JPY
Regular price Sale price ¥272,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Canis familiaris (Dog) (Canis lupus familiaris)

Uniprot NO.:P0CAN6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LWVDGGPPSMTVSLGETARLQCLHNRSRLSSKLNITWWRVLQGNATWPDIFLSYGKGPNGELTIDTVNKSHMGMYRCQVEEKDLNQKILSSQQSCGTYLRVRERLPRPFLDMGEGTKNNIITAEGIILLFCAVVPGTLLLFRKRWQNMKFGVDAQDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLHIGDGDVQLEKP

Protein Names:Recommended name: B-cell antigen receptor complex-associated protein alpha chain Alternative name(s): Ig-alpha CD_antigen= CD79a

Gene Names:Name:CD79A

Expression Region:33-236

Sequence Info:full length protein

View full details