Recombinant Dictyostelium discoideum  Uncharacterized transmembrane protein DDB_G0281147(DDB_G0281147)

Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0281147(DDB_G0281147)

CSB-CF690715DKK
Regular price
¥167,700 JPY
Sale price
¥167,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54UD3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLDDIENNNNDHGQFMPMYDEGVNFPSYSNNFQPLKIEKNDKEDRQVTCSIVLFVLGFL LLIPWIINVINIKSKNKMARGFSIASVVLFSLSIAIIVIFVIFFIFLITSLHNSHREDR

Protein Names:Recommended name: Uncharacterized transmembrane protein DDB_G0281147

Gene Names:ORF Names:DDB_G0281147

Expression Region:1-119

Sequence Info:full length protein

Your list is ready to share