Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Ponticulin(ponA)

Recombinant Dictyostelium discoideum Ponticulin(ponA)

SKU:CSB-YP345793DKK

Regular price ¥209,400 JPY
Regular price Sale price ¥209,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P54660

Gene Names: ponA

Organism: Dictyostelium discoideum (Slime mold)

AA Sequence: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS

Expression Region: 23-118aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 11.9 kDa

Alternative Name(s):

Relevance: Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.

Reference: "F-actin affinity chromatography of detergent-solubilized plasma membranes: purification and initial characterization of ponticulin from Dictyostelium discoideum."Wuestehube L.J., Speicher D.W., Shariff A., Luna E.J.Methods Enzymol. 196:47-65(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details