Gene Bio Systems
Recombinant Dictyostelium discoideum NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(ndufa13)
Recombinant Dictyostelium discoideum NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(ndufa13)
SKU:CSB-CF774769DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:Q86IZ2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVGYRQKWVQDLPPAGGFPKLKYARTSTSPIPGAYIFAGVFSIMAVGTYIFFSDKVERNA REEEEKRRLSMILPILQAENDINFLASPHQNVYFTRWMPPQTGKRAAALLRDL
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Gene Names:Name:ndufa13 ORF Names:DDB_G0274311
Expression Region:1-113
Sequence Info:full length protein
![Recombinant Dictyostelium discoideum NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(ndufa13)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_83156e84-5b10-4fea-a38c-4a17c4c331c1.jpg?v=1659247442&width=1445)