Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(ndufa13)

Recombinant Dictyostelium discoideum NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(ndufa13)

SKU:CSB-CF774769DKK

Regular price ¥224,900 JPY
Regular price Sale price ¥224,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q86IZ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVGYRQKWVQDLPPAGGFPKLKYARTSTSPIPGAYIFAGVFSIMAVGTYIFFSDKVERNA REEEEKRRLSMILPILQAENDINFLASPHQNVYFTRWMPPQTGKRAAALLRDL

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

Gene Names:Name:ndufa13 ORF Names:DDB_G0274311

Expression Region:1-113

Sequence Info:full length protein

View full details