Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dictyostelium discoideum Membrane protein P8A7(pmpA)

Recombinant Dictyostelium discoideum Membrane protein P8A7(pmpA)

SKU:CSB-CF318811DKK

Regular price ¥264,500 JPY
Regular price Sale price ¥264,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:P11022

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQSTAYIILNILVILAGCFITACGIYLFVNGLFHSIIGFVLGIYYLLAGVCIVLLEIVF PQKLVNLFGFYTYWFGKGALISLIGLLILGNSGFFLAAGIIVIAVGIVCMIFHFLLGCPR PLINRSVERKPEPQGQHA

Protein Names:Recommended name: Membrane protein P8A7

Gene Names:Name:pmpA Synonyms:P8A7 ORF Names:DDB_G0269170

Expression Region:1-138

Sequence Info:full length protein

View full details