Gene Bio Systems
Recombinant Dictyostelium discoideum Membrane protein P8A7(pmpA)
Recombinant Dictyostelium discoideum Membrane protein P8A7(pmpA)
SKU:CSB-CF318811DKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:P11022
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSQSTAYIILNILVILAGCFITACGIYLFVNGLFHSIIGFVLGIYYLLAGVCIVLLEIVF PQKLVNLFGFYTYWFGKGALISLIGLLILGNSGFFLAAGIIVIAVGIVCMIFHFLLGCPR PLINRSVERKPEPQGQHA
Protein Names:Recommended name: Membrane protein P8A7
Gene Names:Name:pmpA Synonyms:P8A7 ORF Names:DDB_G0269170
Expression Region:1-138
Sequence Info:full length protein
