Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfovibrio vulgaris Protein CrcB homolog(crcB)

Recombinant Desulfovibrio vulgaris Protein CrcB homolog(crcB)

SKU:CSB-CF491691DJR

Regular price ¥256,000 JPY
Regular price Sale price ¥256,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

Uniprot NO.:B8DJU6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQKIVLLGLAGALGSLARYGLAGLVQRAAPGSFPLGTFIVNVLGCLAFGFVWGVCENRIS LHPDLRVVLLTGFMGAFTTFSTFTFESLGLMETGQWLAFALYAGGQLLLGLALLWLGLGT GRLV

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:DvMF_0461

Expression Region:1-124

Sequence Info:full length protein

View full details