Skip to product information
1 of 1

Gene Bio Systems

Recombinant Desulfovibrio desulfuricans UPF0059 membrane protein Dde_2978(Dde_2978)

Recombinant Desulfovibrio desulfuricans UPF0059 membrane protein Dde_2978(Dde_2978)

SKU:CSB-CF654499DAAF

Regular price ¥275,600 JPY
Regular price Sale price ¥275,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Desulfovibrio desulfuricans (strain G20)

Uniprot NO.:Q30X24

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:METPALLALAVALAMDALAVAVATGCRLRTVSARQTLRLAWHFGLFQAAMPIAGWFMGQG IRSFVDAWAHWIAFGLLAFIGLKMLKEAFEHDDAECGMADPTRGTSLIMLSVATSIDALA VGVTLSMLGLSIWMPAAVIGLVCLGLTAAGVQLGRVLAASSALSRYAEILGGAVLLGIGF KILHESGVFG

Protein Names:Recommended name: UPF0059 membrane protein Dde_2978

Gene Names:Ordered Locus Names:Dde_2978

Expression Region:1-190

Sequence Info:full length protein

View full details