Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dense granule protein 7(GRA7)

Recombinant Dense granule protein 7(GRA7)

SKU:CSB-CF515306TOV

Regular price ¥277,700 JPY
Regular price Sale price ¥277,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Toxoplasma gondii

Uniprot NO.:O00933

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATASDDELMSRIRNSDFFDGQAPVDSLRPTNAGVDSKGTDDHLTTSMDKASVESQLPRRE PLETEPDEQEEVHFRKRGVRSDAEVTDDNIYEEHTDRKVVPRKSEGKRSFKDLLKKLALP AVGMGASYFAADRLVPELTEEQQRGDEPLTTGQNVGTVLGFAALAAAAAFLGMGLTRTYR HFSPRKNRSRQPALEQEVPESGEDGEDARQ

Protein Names:Recommended name: Dense granule protein 7 Short name= Protein GRA 7 Alternative name(s): 29 kDa excretory dense granule protein p29

Gene Names:Name:GRA7

Expression Region:27-236

Sequence Info:full length protein

View full details