Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dense granule protein 6(GRA6)

Recombinant Dense granule protein 6(GRA6)

SKU:CSB-CF631656TOV

Regular price ¥244,900 JPY
Regular price Sale price ¥244,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Toxoplasma gondii

Uniprot NO.:Q27003

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAHGGIHLRQKRNFCPVTVSTVAVVFVVFMGVLVNSLGGVAVAADSGGVKQTPSETGSSG GQQEAVGTTEDYVNSSAMGGGQGDSLAEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLE ERIEEQGTRRRYSSVQEPQAKVPSKRTQKRHRLIGAVVLAVSVAMLTAFFLRRTGRRSPQ EPSGDGGGNDAGNNAGNGGNEGRGYGGRGEGGAEDDRRPLHPERVNVFDY

Protein Names:Recommended name: Dense granule protein 6 Short name= Protein GRA 6 Alternative name(s): Antigen p32 Protein p33

Gene Names:Name:GRA6 Synonyms:TG24

Expression Region:1-230

Sequence Info:full length protein

View full details