Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dehalococcoides sp. UPF0059 membrane protein DehaBAV1_0963 (DehaBAV1_0963)

Recombinant Dehalococcoides sp. UPF0059 membrane protein DehaBAV1_0963 (DehaBAV1_0963)

SKU:CSB-CF402153DHU

Regular price ¥275,900 JPY
Regular price Sale price ¥275,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dehalococcoides sp. (strain BAV1)

Uniprot NO.:A5FQH9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLLSVIFIALGLSADCFAVSIGIACTHASIKSRVIWRVAGTFGLFQAGMVVIGFFAGLS VIDIISAFDHWIAFGLLLFIGVRMIYEALQGEDDQELVKLDLTRGLGLLGVAVATSIDAL AVGLAFAVEETNIGLAALLIGLVSLTVSFLGFKLGNRISFMASRWVGVAGGLVLVFIGLK ILAEHTLGWDILL

Protein Names:Recommended name: UPF0059 membrane protein DehaBAV1_0963

Gene Names:Ordered Locus Names:DehaBAV1_0963

Expression Region:1-193

Sequence Info:full length protein

View full details