Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Uniprot NO.:Q6BYU3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFDISSSNLLISVLVVLFAKQLINAVGKATLENIGWSAYCKVAPKLGDSKFIALDQKNVE LAKVSKERKSISAQDQYARWTKLNRQFDKLTGEINKLKEETSASRSYISKYIGYMILVTT TLPIWFFRVWFRKAVLFYFPTGVLPHYLEWFLALPFITTGGVGLTIWMSAVNNVVSSVIF LVKFPFEKEVPFPSKEVGNEKTSINKEEVSGTPAAN
Protein Names:Recommended name: Golgi to ER traffic protein 1 Alternative name(s): Guided entry of tail-anchored proteins 1
Gene Names:Name:GET1 Ordered Locus Names:DEHA2A06930g
Expression Region:1-216
Sequence Info:full length protein