Skip to product information
1 of 1

Gene Bio Systems

Recombinant Debaryomyces hansenii Altered inheritance of mitochondria protein 36, mitochondrial(AIM36)

Recombinant Debaryomyces hansenii Altered inheritance of mitochondria protein 36, mitochondrial(AIM36)

SKU:CSB-CF728223DIS

Regular price ¥285,300 JPY
Regular price Sale price ¥285,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Uniprot NO.:Q6BWY8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QLYSTKANNEPPKLRFLFYMFIFASGVLYVTGSQIEKKKPKSSFTEKEFEEYESSSGLKR RSKLISTQDAEKYKFFVVPYVHQNEFITKIAQKLGDKEVRIIDPEELIKREREDESRHYS YLLQDLAQEDKPLPKGLVTALIKDDIKFYLNTRNGTFDTNFLIKNYPQTTDEAIKFENDI SDISKCIVLHYDMLNELKKNKGEENARLINNVVGYYETVNKAKIITAKHDELDDKLQEIS LEFI

Protein Names:Recommended name: Altered inheritance of mitochondria protein 36, mitochondrial Alternative name(s): Found in mitochondria protein 39

Gene Names:Name:AIM36 Synonyms:FMP39 Ordered Locus Names:DEHA2B07414g

Expression Region:36-279

Sequence Info:full length protein

View full details