Skip to product information
1 of 1

Gene Bio Systems

Recombinant Dasypus novemcinctus ATP synthase subunit a(MT-ATP6)

Recombinant Dasypus novemcinctus ATP synthase subunit a(MT-ATP6)

SKU:CSB-CF015070DIO

Regular price ¥273,900 JPY
Regular price Sale price ¥273,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dasypus novemcinctus (Nine-banded armadillo)

Uniprot NO.:O21330

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNENLFASFATPTMMGLPIIMLIIMFPSILFPTPKRMITNRVVSVQQWLINMIMKQMMNI HNNKGRTWTLMLISLITFIGTTNLLGLLPHTFTPTTQLSMNLGMAIPLWAGAVVTGFRHK TKASLAHFLPQGTPIPLIPMLIIIQTISLFIQPMALAVRLTANITAGHLLIHLIGGATLA LMSISPTTASITFIILILLTILEFAVALIQAYVFTLLVSLYLHDNT

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6

Gene Names:Name:MT-ATP6 Synonyms:ATP6, ATPASE6, MTATP6

Expression Region:1-226

Sequence Info:full length protein

View full details