Gene Bio Systems
Recombinant Danio rerio Zinc finger protein-like 1(zfpl1)
Recombinant Danio rerio Zinc finger protein-like 1(zfpl1)
SKU:CSB-CF026462DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:P62447
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLCKCPKKKVTNLFCFKHRVNVCEHCLVSNHNKCIVQSYLQWLQDSDYNPNCSLCIQPLDSQDTVRLVCYDLFHWSCLNELASHQPLNTAPDGYQCPTCQGPVFPPRNLASPVADMLREQLSSVNWARAGLGLPLIEDPEEEETTTHSGTSFSEWSTFETTSVDVSMSNPTLTSLPPHQDGEHIYNNREQSAPNNTVFNMVTTSATDTVTISTVTSPRKLYDTRDLGHSAVMQIDFDDDKYRRRPALNWFAQVLKNCTSTKKKTLALKHRIFLLLLFGVIGFFTLIIIMAKFGRASAETDPNLDPLLNPNIRIGNM
Protein Names:Recommended name: Zinc finger protein-like 1
Gene Names:Name:zfpl1 ORF Names:zgc:63760
Expression Region:1-317
Sequence Info:full length protein
