Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio UPF0694 transmembrane protein C14orf109 homolog(si:dkeyp-55f12.4, zgc:112233)

Recombinant Danio rerio UPF0694 transmembrane protein C14orf109 homolog(si:dkeyp-55f12.4, zgc:112233)

SKU:CSB-CF719435DIL

Regular price ¥266,500 JPY
Regular price Sale price ¥266,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q5TZA3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMNFRQRMGWIGVGLYLLASVAAVYYIFEISQTYNRLALAQVEKTSGAQAKWPGDASSSS PSSTSWIVTLKTRLLLLPFWVWATIFLLPYLQVFLFLYSCTRADPKTVGYCILPICLAVL CNRHQTFTKASNQISRLQLIDT

Protein Names:Recommended name: UPF0694 transmembrane protein C14orf109 homolog

Gene Names:ORF Names:si:dkeyp-55f12.4, zgc:112233

Expression Region:1-142

Sequence Info:full length protein

View full details