Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Transmembrane protein C5orf28 homolog(si:busm1-79m10.4, si:dz79m10.4)

Recombinant Danio rerio Transmembrane protein C5orf28 homolog(si:busm1-79m10.4, si:dz79m10.4)

SKU:CSB-CF718716DIL

Regular price ¥281,400 JPY
Regular price Sale price ¥281,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6DC75

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVPLNLAVETEKAQALLQTFSTASLFASAGLGAFCFVADHFLTLPFIQHHLWLRALFDN TVHAIIGLWSWAIVIGLRKKSDFYEVILAGFLASVIDLDHFYMAGSLSIKAAVNLPHRPP LHCSTLIPALCFSLRLLMWACRLKDSWCSLPWMLFISLTSHHIRDGVRHGLWVCPFGNTA PISYWLYVTITATLPHLCSVLMYLTGTRDMISTKHGVAIDV

Protein Names:Recommended name: Transmembrane protein C5orf28 homolog

Gene Names:ORF Names:si:busm1-79m10.4, si:dz79m10.4

Expression Region:1-221

Sequence Info:full length protein

View full details