Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Sugar transporter SWEET1(slc50a1)

Recombinant Danio rerio Sugar transporter SWEET1(slc50a1)

SKU:CSB-CF688682DIL

Regular price ¥279,700 JPY
Regular price Sale price ¥279,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q5EB14

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDFLQLLSCACIIFTVGMFTTGLTDLKKMKATQSADNVQFLPFLTTCLNNLGWLYYGLLK GDGTVIFVNIIGAFLQTVYIATYCHYTKEKRRVYTQTLLMVSVLCVAWVYFSLVISPGEA QLSQLGLTCSVFTISMYLSPLADLLDIMRTKSVERLSFSLTVATFFTSTSWTLYGLQLGD YYIMVPNTPGIFTSLIRFFLFWWFGAVIPQIPSYKLIQI

Protein Names:Recommended name: Sugar transporter SWEET1 Alternative name(s): RAG1-activating protein 1 Solute carrier family 50 member 1

Gene Names:Name:slc50a1 Synonyms:rag1ap1 ORF Names:zgc:113092

Expression Region:1-219

Sequence Info:full length protein

View full details