Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Serine palmitoyltransferase small subunit A(sptssa)

Recombinant Danio rerio Serine palmitoyltransferase small subunit A(sptssa)

SKU:CSB-CF691500DIL

Regular price ¥251,700 JPY
Regular price Sale price ¥251,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q5BJC1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFGDAWKQLSWFYYQYLLVTALYMLEPWERTIFNSLLISVAAMAVYTGYVFMPQHIMAI LHYFEVVQ

Protein Names:Recommended name: Serine palmitoyltransferase small subunit A Alternative name(s): Small subunit of serine palmitoyltransferase A Short name= ssSPTa

Gene Names:Name:sptssa Synonyms:ssspta ORF Names:zgc:112487

Expression Region:1-68

Sequence Info:full length protein

View full details