Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Ribonuclease kappa-A(rnaseka)

Recombinant Danio rerio Ribonuclease kappa-A(rnaseka)

SKU:CSB-CF606682DIL

Regular price ¥257,800 JPY
Regular price Sale price ¥257,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q0P467

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSLLFCGPKLAACGLVLSIWGVIMLALLGIFFTTHSAILIEDVPLTEEDLHSQDTPPQS VYKLYNQVGYNCFIAAVIYVGIGFLSFCQVRLNKRKEYLVH

Protein Names:Recommended name: Ribonuclease kappa-A Short name= RNase K-A Short name= RNase kappa-A EC= 3.1.-.-

Gene Names:Name:rnaseka ORF Names:zgc:153350

Expression Region:1-101

Sequence Info:full length protein

View full details