Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Protein FAM162B(fam162b)

Recombinant Danio rerio Protein FAM162B(fam162b)

SKU:CSB-CF008112DIL

Regular price ¥267,700 JPY
Regular price Sale price ¥267,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:A3KP48

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSMIRGPRAAFGTLIGQWRRGMMTTGNRRLCIKPQEGPSASPQTQRPGFKLPGYRPSDW DKKMLMWSGRFKTVEQIPEFVSFEMIDAARNRVRVKACYIMMGLTIFACLVMIVSGKKAV SRKESLIAINMEKKAKWREDAQREKEENALDAKAQ

Protein Names:Recommended name: Protein FAM162B

Gene Names:Name:fam162b ORF Names:zgc:162943

Expression Region:1-155

Sequence Info:full length protein

View full details