Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Protein cornichon homolog 2(cnih2)

Recombinant Danio rerio Protein cornichon homolog 2(cnih2)

SKU:CSB-CF710680DIL

Regular price ¥269,900 JPY
Regular price Sale price ¥269,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q5BL21

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFTFAAFCYMLTLVLCAALIFFVIWQIIAFDELRTDFKNPIDQSNPTRARERILNIERI CNLLRRLVVPEYSIHGLFCLMFMCAGEWVTLGLNIPLLLYHLWRFFHRPADGSEVMYDPV SVMNADILNYCQKESWCKLGFYLLSFFYYLYSMVYALVSF

Protein Names:Recommended name: Protein cornichon homolog 2

Gene Names:Name:cnih2 ORF Names:zgc:101874

Expression Region:1-160

Sequence Info:full length protein

View full details