Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio NADH-ubiquinone oxidoreductase chain 6(mt-nd6)

Recombinant Danio rerio NADH-ubiquinone oxidoreductase chain 6(mt-nd6)

SKU:CSB-CF878730DIL-GB

Regular price ¥272,200 JPY
Regular price Sale price ¥272,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q9MIX9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFYLSFLMAALVGGMIAIASNPAPYFAAFGLVVVAGVGCGILVSYGGSFLSLILFLIYL GGMLVVFAYSAALAAEPFPEAWGDRVVFWRVMVYGLVVIVAAGFLLTGDTGLLMSVDAFK EFSVIRADVSGVAMMYSSGGKMLVICAWVLLLTLFVVLEVTRGLSYGVLRAI

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 6 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 6

Gene Names:Name:mt-nd6 Synonyms:mtnd6, nd6

Expression Region:1-172

Sequence Info:full length protein

View full details