Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Melatonin receptor type 1B-A(mtnr1ba)

Recombinant Danio rerio Melatonin receptor type 1B-A(mtnr1ba)

SKU:CSB-CF838556DIL

Regular price ¥292,600 JPY
Regular price Sale price ¥292,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q90456

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPENVSLIRNRTEVGQGRAWGSGAGARPAWVVMVLAGVLIFTSVVDVLGNVLVIISVLRN RKLRNAGNAFVVSLAFADLLVVCYPYPLVLHAMLHAGWLPGEMECKVSGFLMGASVIGSI FNITAIAINRYCFICQANTYEKIYGRAGTLVLLTLVWVLTAIAILPNLSLGSLTYDPRVY SCTFSQTTSAGYTIAVVTVHFLLPIAVVTFCYLRIWVLVLRVRRRVTTDVRPRLRPSELR HFLTMFVVFVLFAVCWAPLNLIGLAVAVDPPRVGPLVPDWLFVMSYF

Protein Names:Recommended name: Melatonin receptor type 1B-A Short name= Mel-1B-R-A Short name= Mel1b receptor A Alternative name(s): Melatonin receptor Mel1b Z6.2 Melatonin receptor Mel1b-19 zMel1b-2

Gene Names:Name:mtnr1ba Synonyms:mel1b, mtnr1b

Expression Region:1-287

Sequence Info:full length protein

View full details