Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Melatonin receptor type 1A-like(mtnr1al)

Recombinant Danio rerio Melatonin receptor type 1A-like(mtnr1al)

SKU:CSB-CF343120DIL

Regular price ¥267,100 JPY
Regular price Sale price ¥267,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:P51047

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CHSLKYDKLFSNKNTVCYVILVWALTVLAIVPNWFVESLQYDPRVFSCTFAQSVSSLYTI MVVVVHFIVPIGIVTYCYLRIWILVIQVPRRVKPDSRPKIKPHDFRNFLTMFVVFVLFAV CWAPLNFIGLAVAIHPRLGQSIPEWLFTASYF

Protein Names:Recommended name: Melatonin receptor type 1A-like Short name= Mel-1A-R-like Short name= Mel1a receptor-like Alternative name(s): Melatonin receptor Mel1a Z1.4 zMel1a-2

Gene Names:Name:mtnr1al Synonyms:mel1a, mtnr1a

Expression Region:1-152

Sequence Info:full length protein

View full details