Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Leptin receptor gene-related protein(leprot)

Recombinant Danio rerio Leptin receptor gene-related protein(leprot)

SKU:CSB-CF710026DIL

Regular price ¥263,000 JPY
Regular price Sale price ¥263,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q561T9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGIKALVALSFSGALGLTFLLLGCALEQFGQYWPMFVLIFYILSPIPNLIARRHADDTE SSNACRELAYFLTTGIVVSAYGLPVVLARKAVIQWGAAGLVMAGNCVIFLTILGFFLIFG GGDDFSWEQW

Protein Names:Recommended name: Leptin receptor gene-related protein Alternative name(s): OB-R gene-related protein Short name= OB-RGRP

Gene Names:Name:leprot Synonyms:lepr-grp ORF Names:zgc:112430

Expression Region:1-130

Sequence Info:full length protein

View full details