Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 1(ergic1)

Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 1(ergic1)

SKU:CSB-CF703296DIL

Regular price ¥293,100 JPY
Regular price Sale price ¥293,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q4V8Y6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFDVRRFDIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFIATEIVNELYVDD PDKDSGGKIDVSLNISLPNLHCDLVGLDIQDEMGRHEVGHIENSMKVPLNNGHGCRFEGE FSINKVPGNFHVSTHSATAQPQSPDMTHIIHKLAFGAKLQVQHVQGAFNALGGADRLQSN ALASHDYILKIVPTVYEELGGKQRFSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITV KYTERRRPFYRFITTICAIIGGTFTVAGIIDSCIFTASEAWKKIQIGKMS

Protein Names:Recommended name: Endoplasmic reticulum-Golgi intermediate compartment protein 1 Alternative name(s): ER-Golgi intermediate compartment 32 kDa protein Short name= ERGIC-32

Gene Names:Name:ergic1 Synonyms:ergic32 ORF Names:zgc:114085

Expression Region:1-290

Sequence Info:full length protein

View full details