Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Bladder cancer-associated protein(blcap)

Recombinant Danio rerio Bladder cancer-associated protein(blcap)

SKU:CSB-CF881257DIL

Regular price ¥221,100 JPY
Regular price Sale price ¥221,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q9IB61

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYCLQWLLPVLLIPKPLNPALWFNHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCHDSPLPDSAHDPSIVGT

Protein Names:Recommended name: Bladder cancer-associated protein Alternative name(s): ZfBc10

Gene Names:Name:blcap ORF Names:zgc:73246

Expression Region:1-87

Sequence Info:full length protein

View full details