Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cytochrome c oxidase subunit 1(COX1)

Recombinant Cytochrome c oxidase subunit 1(COX1)

SKU:CSB-CF654240EBAB

Regular price ¥270,600 JPY
Regular price Sale price ¥270,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ephedra equisetifolia

Uniprot NO.:Q33439

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISQIVSTLSG KQVFGYLGMVYAMISIGVLGFMVWAHHMFTVGLDVDTRAYFTAATMIIAVPTGIKIFSWI ATMWGGSIRSITPMLFAVGFLFLFTIGGLTGIVLANSGLDIALHDTYYVVAH

Protein Names:Recommended name: Cytochrome c oxidase subunit 1 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide I

Gene Names:Name:COX1 Synonyms:COI, COXI

Expression Region:1-172

Sequence Info:full length protein

View full details